PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sobic.006G183200.1.p
Common NameSb06g025750, SORBIDRAFT_06g025750
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Sorghinae; Sorghum
Family HD-ZIP
Protein Properties Length: 803aa    MW: 86140.3 Da    PI: 5.6842
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sobic.006G183200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox63.53.1e-20103158156
                           TT--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
              Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                           +r+  ++t++q+ +Le++F++ ++p++++r+eL+k+lgL+ rqVk+WFqNrR+  k
  Sobic.006G183200.1.p 103 KRRYNRHTPHQIARLEAMFKEFPHPDEKQRAELSKQLGLEPRQVKFWFQNRRTNAK 158
                           677889**********************************************9888 PP

2START172.82.1e-543155422206
                           HHHHHHHHHHHHHHHC-TT-EEEE........EXCCTTEEEEEEESSS......SCEEEEEEEECCSCHHH.HHHHHHCCCGGCT-TT- CS
                 START   2 laeeaaqelvkkalaeepgWvkss........esengdevlqkfeeskv.....dsgealrasgvvdmvla.llveellddkeqWdetl 76 
                           la +a++elvk+a+ +ep+W  s+        e +n +e+l+ f++  +     + +ea+r+sg+v+ ++   lve ++d + +W+ ++
  Sobic.006G183200.1.p 315 LAVSAMNELVKMAQTNEPLWIPSAsspgsptmETLNFKEYLKAFTPCVGvkrngFVSEASRESGIVTVDSSaALVEAFMDER-RWSDMF 402
                           7889*****************999999*99999999********98655899999***********9987758999999999.****** PP

                           S....EEEEEEEECTT......EEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--.-TTSEE-EESSEEEEE CS
                 START  77 a....kaetlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgili 154
                                ka+t+e is+g      gal lm+aelq+lsplvp R+++f+R+++ql +  w++vdvS+d  q+    +   ++++lpSg+++
  Sobic.006G183200.1.p 403 ScivaKAATIEEISPGvagsrnGALLLMQAELQVLSPLVPiREVTFLRFCKQLAESAWAVVDVSIDGLQMDHCLATNTKCRRLPSGCVL 491
                           **********************************************************************98899************** PP

                           EEECTCEEEEEEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXXX CS
                 START 155 epksnghskvtwvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                           ++++ng +kvtwveh+++ ++++h+l+++l+ sgla ga +w+atlqrqce+
  Sobic.006G183200.1.p 492 QDTPNG-CKVTWVEHAEYPEASVHQLYQPLLCSGLALGAGRWLATLQRQCEC 542
                           ******.*******************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.6E-2290154IPR009057Homeodomain-like
SuperFamilySSF466896.68E-2092160IPR009057Homeodomain-like
PROSITE profilePS5007118.447100160IPR001356Homeobox domain
SMARTSM003892.6E-20101164IPR001356Homeobox domain
CDDcd000869.97E-20101161No hitNo description
PfamPF000461.0E-17103158IPR001356Homeobox domain
PRINTSPR000318.5E-5131140IPR000047Helix-turn-helix motif
PROSITE patternPS000270135158IPR017970Homeobox, conserved site
PRINTSPR000318.5E-5140156IPR000047Helix-turn-helix motif
PROSITE profilePS5084844.157305545IPR002913START domain
SuperFamilySSF559611.18E-28307542No hitNo description
CDDcd088755.12E-106309541No hitNo description
SMARTSM002346.1E-45314542IPR002913START domain
PfamPF018524.3E-46315542IPR002913START domain
SuperFamilySSF559611.56E-17563768No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 803 aa     Download sequence    Send to blast
MSFGDLLDGG GSAAGVQFPY GVFASSPALS LAVVDAGRRR DGGSAARAGS SARRGGGGNG  60
KDASEAENEG QSMVSGHLDV VLSGGGDGED DEDGEDANPR KRKRRYNRHT PHQIARLEAM  120
FKEFPHPDEK QRAELSKQLG LEPRQVKFWF QNRRTNAKNQ MERQENARLK QENDKLRVEN  180
LSIREAMRDL VCSGCGGPAV LGDLSLEERH LRLENARLRD ELARVCTLTA KFIGKPMSHM  240
ELLAVAEEPH PMPGSSLELA VAGGVGSGVP SSKMPVSTIS ELAGSTSSAM GTVITPMVTA  300
SLPMVSIDKS KFAQLAVSAM NELVKMAQTN EPLWIPSASS PGSPTMETLN FKEYLKAFTP  360
CVGVKRNGFV SEASRESGIV TVDSSAALVE AFMDERRWSD MFSCIVAKAA TIEEISPGVA  420
GSRNGALLLM QAELQVLSPL VPIREVTFLR FCKQLAESAW AVVDVSIDGL QMDHCLATNT  480
KCRRLPSGCV LQDTPNGCKV TWVEHAEYPE ASVHQLYQPL LCSGLALGAG RWLATLQRQC  540
ECLAILMSSL AVPEHDSEAV SLEGKRSLLK LARRMMENFC AGMSASSSCE WSILDGLTGS  600
MGKDVRVMVQ NSVDEPGVPP GVVLSVATAV WLPVTPERLF NFLRDEELRA EWDILSNGGP  660
MQQMLRITKG QLDGNSVTLL RADHTNSHLN SILILQETCT DRSGAMVVYA PVDFPAMQLV  720
IGGGDSTNVA LLPSGFVILP DGSSSSAGGV GHKTCGSLLT VAFQILVNSQ PTAKLTVESV  780
DTVYNLISCT IEKIRAALHC DI*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
199104RKRKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ2509840.0AJ250984.1 Zea mays mRNA for OCL2 protein (ocl2 gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002448357.10.0hypothetical protein SORBIDRAFT_06g025750
SwissprotQ7Y0V90.0ROC4_ORYSJ; Homeobox-leucine zipper protein ROC4
TrEMBLC5YE330.0C5YE33_SORBI; Putative uncharacterized protein Sb06g025750
STRINGSb06g025750.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP120337116
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.10.0homeodomain GLABROUS 1